PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS59204 to PF05957 (DUF883)

VIMSS59204 has 109 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      1e-33  102.1   1.4    1.5e-33  101.6   1.4    1.2  1  VIMSS59204  


Domain annotation for each sequence (and alignments):
>> VIMSS59204  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.6   1.4   1.5e-33   1.5e-33       2      94 .]      17     109 .]      16     109 .] 0.99

  Alignments for each domain:
  == domain 1  score: 101.6 bits;  conditional E-value: 1.5e-33
      DUF883   2 eleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                 +++ael++l+a++++l++ +++ ag+e ++lRe++++ l+r r++++++++ v++r+++aaea+++yV+++Pwq+++++ag G+llGlL+ rR
  VIMSS59204  17 QAMAELQDLIAEVDQLMSGTGSLAGKEGANLREQINSVLHRGRDAIERTRRGVVQRSQAAAEATEEYVEDHPWQTIAVSAGAGFLLGLLMGRR 109
                 789*****************************************************************************************9 PP



Or compare VIMSS59204 to CDD or PaperBLAST