PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS622195 to PF05957 (DUF883)

VIMSS622195 has 101 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.9e-35  105.4   1.2    1.1e-34  105.2   1.2    1.0  1  VIMSS622195  


Domain annotation for each sequence (and alignments):
>> VIMSS622195  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.2   1.2   1.1e-34   1.1e-34       2      94 .]       9     101 .]       8     101 .] 0.99

  Alignments for each domain:
  == domain 1  score: 105.2 bits;  conditional E-value: 1.1e-34
       DUF883   2 eleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                   l+ael+sl ++lee+l+++ d+ + e+++lR+++e++l+++r rl+++++++a+++ke+a++ad+yV++nPw+ vGi+a+vG++lG+Ll+rR
  VIMSS622195   9 HLRAELKSLADTLEEVLQSSTDKPKAELDKLRAKAESALKDTRVRLSETSDKIAAQTKEIADKADNYVHDNPWTGVGIGAAVGVVLGVLLSRR 101
                  689*****************************************************************************************9 PP



Or compare VIMSS622195 to CDD or PaperBLAST