PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS79687 to PF05957 (DUF883)

VIMSS79687 has 103 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.8e-29   87.5   0.1    4.3e-29   87.3   0.1    1.0  1  VIMSS79687  


Domain annotation for each sequence (and alignments):
>> VIMSS79687  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.3   0.1   4.3e-29   4.3e-29       1      94 []      10     103 .]      10     103 .] 0.98

  Alignments for each domain:
  == domain 1  score: 87.3 bits;  conditional E-value: 4.3e-29
      DUF883   1 eeleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                 +el +e++++l+++eel++e+++ + +e+++l+++l++r++++++++  +++++++ +ke+++++d+ V++nP++a+G+A ++GlllG+L++++
  VIMSS79687  10 DELLSEIREILDNAEELFDEKSKASVDELKKLKSNLDSRVSKLQKQFGVLKDDAVAGTKEVIKQTDELVQDNPYKAIGVAGVIGLLLGVLISKK 103
                 57899**************************************************************************************985 PP



Or compare VIMSS79687 to CDD or PaperBLAST