PaperBLAST – Find papers about a protein or its homologs

 

Align NP_415773.1 to PF05974 (DUF892)

NP_415773.1 has 168 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-52  163.9   0.3    1.8e-52  163.7   0.3    1.0  1  NP_415773.1  


Domain annotation for each sequence (and alignments):
>> NP_415773.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  163.7   0.3   1.8e-52   1.8e-52       4     157 ..       5     155 ..       2     157 .. 0.98

  Alignments for each domain:
  == domain 1  score: 163.7 bits;  conditional E-value: 1.8e-52
                  HHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH... CS
       DUF892   4 elfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaalia 100
                  e+++d+LrD++a+Ekq++++l++ma+++++ peL+a++eqHl eT++qi +Le +++r + s s +k d+m++++a gq +++ +++de++k+ +   
  NP_415773.1   5 EHYHDWLRDAHAMEKQAESMLESMASRIDNyPELRARIEQHLSETKNQIVQLETILDRNDISRSVIK-DSMSKMAALGQSIGGIFPSDEIVKGSI--- 98 
                  89*****************************************************************.***************************... PP

                  HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892 101 aaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqe 157
                  +++ +e++EiA+Y++L+a+A+++g++    ++e++l+eek+++++l++ ++++++++
  NP_415773.1  99 SGYVFEQFEIACYTSLLAAAKNAGDTASIPTIEAILNEEKQMADWLIQNIPQTTEKF 155
                  ****************************************************99987 PP



Or compare NP_415773.1 to CDD or PaperBLAST