PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1182980 to PF05974 (DUF892)

VIMSS1182980 has 169 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    8.4e-54  168.1   4.0    9.4e-54  167.9   4.0    1.0  1  VIMSS1182980  


Domain annotation for each sequence (and alignments):
>> VIMSS1182980  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  167.9   4.0   9.4e-54   9.4e-54       2     157 ..       4     156 ..       3     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: 167.9 bits;  conditional E-value: 9.4e-54
                   .HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH CS
        DUF892   2 leelfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaa 97 
                   ++e+++d+LrD++a+E+q++++l+++a+++e+ p+Lka++eqHleeT gq + +e+++erlg s+s +k dam +++a gq++++++++de++k+a+
  VIMSS1182980   4 PQENLMDWLRDAHAMEQQAEQMLKAQAARIEHyPQLKARIEQHLEETLGQQRLVESCIERLGGSPSIIK-DAMGKMAAFGQAMGGMTTSDEIVKGAM 99 
                   689******************************************************************.*************************** PP

                   ...HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        DUF892  98 liaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqe 157
                      a++ +e++EiA+Y+ L+ +A+++g++e+++++eq+l +e+a++++l +++++l++++
  VIMSS1182980 100 ---ASYVFENLEIATYTALLGAAKTVGDTETQRVCEQILPQEQAMADWLLAHLPELTEEF 156
                   ...*****************************************************9987 PP



Or compare VIMSS1182980 to CDD or PaperBLAST