PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS122966 to PF05974 (DUF892)

VIMSS122966 has 163 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.5e-67  210.7   8.0    7.3e-67  210.5   8.0    1.0  1  VIMSS122966  


Domain annotation for each sequence (and alignments):
>> VIMSS122966  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.5   8.0   7.3e-67   7.3e-67       1     159 []       6     163 .]       6     163 .] 0.99

  Alignments for each domain:
  == domain 1  score: 210.5 bits;  conditional E-value: 7.3e-67
                  ..HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH. CS
       DUF892   1 tleelfvdeLrDlyaaEkqllkalpkmakaaespeLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaal 98 
                  tl++lf+d+L+D+y+aE+++lkalpkma+aa+ peLkaa+e+H e+Te+++erL+qvfe++g++a++k+c+a+eg++aeg+e+++e ++ ++++da+l
  VIMSS122966   6 TLDDLFHDTLKDIYYAERKILKALPKMARAAQAPELKAAFEKHKEQTETHVERLQQVFEMIGKRAQGKTCEAIEGIVAEGEEIMDE-FKGTAALDAGL 102
                  699***********************************************************************************.*********** PP

                  ..HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH. CS
       DUF892  99 iaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqeaa 159
                  i+aaqavehyEi++YgtL ++A+++g k+a++lL++tl+ee  tde+lt+la ++vn++aa
  VIMSS122966 103 ISAAQAVEHYEISRYGTLKTWAKTIGLKDAVSLLDATLKEEVVTDEDLTKLAMAQVNKKAA 163
                  **********************************************************986 PP



Or compare VIMSS122966 to CDD or PaperBLAST