PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS130846 to PF05974 (DUF892)

VIMSS130846 has 166 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.6e-64  200.5   2.8    9.7e-64  200.4   2.8    1.0  1  VIMSS130846  


Domain annotation for each sequence (and alignments):
>> VIMSS130846  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  200.4   2.8   9.7e-64   9.7e-64       1     156 [.       5     159 ..       5     162 .. 0.98

  Alignments for each domain:
  == domain 1  score: 200.4 bits;  conditional E-value: 9.7e-64
                  ..HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH. CS
       DUF892   1 tleelfvdeLrDlyaaEkqllkalpkmakaaespeLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaal 98 
                  tl++lf+d+ +D+y aE+q+lkalpkma+aa+s++Lkaa+e+H +eTe ++erL++vfe lg+ a++++c+a++g+iaeg+e++ee ++ +s++da+l
  VIMSS130846   5 TLKDLFLDTVKDIYFAERQILKALPKMARAAQSADLKAAFEKHRDETEVHVERLQNVFEFLGKPARGRTCEAIQGIIAEGEEIMEE-FKGSSALDAGL 101
                  699***********************************************************************************.*********** PP

                  ..HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892  99 iaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnq 156
                  i++aqavehyEi++YgtL ++A +lg+keaakl+eqtl ee atd  l+ la++ +n 
  VIMSS130846 102 ISSAQAVEHYEITRYGTLKTWAVELGMKEAAKLFEQTLGEESATDTALSSLAQARANI 159
                  ****************************************************988875 PP



Or compare VIMSS130846 to CDD or PaperBLAST