PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS131406 to PF05974 (DUF892)

VIMSS131406 has 168 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-53  166.8   2.9    2.2e-53  166.7   2.9    1.0  1  VIMSS131406  


Domain annotation for each sequence (and alignments):
>> VIMSS131406  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  166.7   2.9   2.2e-53   2.2e-53       1     158 [.       3     157 ..       3     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: 166.7 bits;  conditional E-value: 2.2e-53
                  ..HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH CS
       DUF892   1 tleelfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaa 97 
                  t++e++v +LrD++a+E+q++++l+++++++e+ peLk+++++Hl+eT++q++ Le+++erl+  +s +k d+  +++a gq l++ +++de++k+++
  VIMSS131406   3 TANEHLVAWLRDAHAMEEQAITMLTSQSSRLENyPELKTRIDRHLQETKDQAAMLERCLERLDGGTSSIK-DISGKIVAFGQGLSGLFVSDEVVKGTL 99 
                  5789******************************************************************.*************************** PP

                  ...HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892  98 liaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqea 158
                     a++++eh+EiAsY++Lia+Aeq+g++e+++++e +l++e a++e+l + a +++++++
  VIMSS131406 100 ---ASYTFEHMEIASYRILIAAAEQAGDQETKRVCESILQQEIAMAEWLAQNAGEITRKFL 157
                  ...*****************************************************99986 PP



Or compare VIMSS131406 to CDD or PaperBLAST