PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS149070 to PF05974 (DUF892)

VIMSS149070 has 168 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.8e-53  165.1   1.1    7.6e-53  164.9   1.1    1.0  1  VIMSS149070  


Domain annotation for each sequence (and alignments):
>> VIMSS149070  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  164.9   1.1   7.6e-53   7.6e-53       3     158 ..       4     156 ..       2     157 .. 0.98

  Alignments for each domain:
  == domain 1  score: 164.9 bits;  conditional E-value: 7.6e-53
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH.. CS
       DUF892   3 eelfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaali 99 
                   e+++d+LrD++a+Ekq++++l++ma+++e+ p++ka++eqH+ eT++qi+ Le+v++r g s s  k d+m++++a gq +++++++de++k+ +  
  VIMSS149070   4 TEHYHDWLRDAHAMEKQAESMLESMASRIENyPDIKARIEQHISETKHQITMLEEVLDRNGISRSVLK-DSMSKMAAMGQSIGGMFPSDEIVKGSI-- 98 
                  79******************************************************************.***************************.. PP

                  .HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892 100 aaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqea 158
                   +++ +e++EiA+Y++L+a+A+++g++    ++e++l+ee +++++l+++++++++q++
  VIMSS149070  99 -SGYVFEQFEIACYTSLLAAAKKAGDTASIPTIEAILKEEMQMADWLIKHIPQTTEQFL 156
                  .******************************************************9975 PP



Or compare VIMSS149070 to CDD or PaperBLAST