PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS162972 to PF05974 (DUF892)

VIMSS162972 has 183 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.1e-49  153.8   8.1    2.4e-49  153.6   8.1    1.0  1  VIMSS162972  


Domain annotation for each sequence (and alignments):
>> VIMSS162972  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.6   8.1   2.4e-49   2.4e-49       2     157 ..      16     171 ..      15     173 .. 0.98

  Alignments for each domain:
  == domain 1  score: 153.6 bits;  conditional E-value: 2.4e-49
                  .HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH.. CS
       DUF892   2 leelfvdeLrDlyaaEkqllkalpkmakaaespeLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaali 99 
                  ++e f+ e   +y+aE++ ++a ++m + +++++L++ +e+H++eTe+qi++Leqvf++lg+++++++cda++gl+++gq+l+  a e++++++++l 
  VIMSS162972  16 FQEKFIYEVGAMYDAEHRFWEAQQTMLQCCQNSQLRSLIETHIRETEQQIRNLEQVFNALGQQPRRVTCDAAAGLVSDGQKLMLLASENQQILNLGLA 113
                  6899*********************************************************************************9************ PP

                  .HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892 100 aaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqe 157
                  + + +ve++EiA+Y+ Li++Aeq+g++++++lL+q+l++e++t +k+++++++l++++
  VIMSS162972 114 GGQAKVEQLEIACYRGLIRAAEQMGQDQVVQLLRQNLQQEEQTSQKIEQHLPQLIQEA 171
                  ******************************************************9986 PP



Or compare VIMSS162972 to CDD or PaperBLAST