PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS253326 to PF05974 (DUF892)

VIMSS253326 has 169 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.2e-52  162.2   4.3    5.8e-52  162.1   4.3    1.0  1  VIMSS253326  


Domain annotation for each sequence (and alignments):
>> VIMSS253326  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  162.1   4.3   5.8e-52   5.8e-52       2     157 ..       4     156 ..       3     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: 162.1 bits;  conditional E-value: 5.8e-52
                  .HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH. CS
       DUF892   2 leelfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaal 98 
                  ++e+++d+LrD++a+E+q++++l+++a+++e+ p+Lka++eqHleeT gq + +e  +erlg s+s +k dam +++a gq++++++++de++k+a+ 
  VIMSS253326   4 PRENLMDWLRDAHAMEQQAEQMLKAQAARIEHyPKLKARIEQHLEETLGQQRLVEASIERLGGSPSVVK-DAMGKMAAFGQAMGGMTTSDEIVKGAM- 99 
                  689******************************************************************.***************************. PP

                  ..HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892  99 iaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqe 157
                    a++ +e++EiA+Y+ L+ +A+++g+ e+++++eq+l +e+a++++l e++++l++++
  VIMSS253326 100 --ASYVFENLEIATYTALLGAAKTVGDVETQRMCEQILPQEEAMAKWLLEHLPELTEEF 156
                  ..*****************************************************9987 PP



Or compare VIMSS253326 to CDD or PaperBLAST