PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS254968 to PF05974 (DUF892)

VIMSS254968 has 171 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.4e-48  149.2   7.4    6.2e-48  149.0   7.4    1.0  1  VIMSS254968  


Domain annotation for each sequence (and alignments):
>> VIMSS254968  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.0   7.4   6.2e-48   6.2e-48       3     158 ..       7     159 ..       5     160 .. 0.98

  Alignments for each domain:
  == domain 1  score: 149.0 bits;  conditional E-value: 6.2e-48
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH.. CS
       DUF892   3 eelfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaali 99 
                  +e +v++L+D+ya+Ek++++++ +ma+++e+ peLk ++eqH+eeT++q + +++++e l+ s  + k  + ++++a ++++++ +++de++k+++  
  VIMSS254968   7 RERLVKWLQDAYAMEKEAETMMAAMASRIEHyPELKRRIEQHVEETQQQSAGVQRCLELLNGSIPTAK-GMLSSVLASMHAAGNSMMTDEVTKGVG-- 101
                  7999****************************************************************.9**************************.. PP

                  .HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892 100 aaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqea 158
                    ++a+eh+EiAsY+ L+ +A+ +ge+e+a+++e++l++e +++e+l+e+ e++v +++
  VIMSS254968 102 -ISYAFEHLEIASYRALVVAARSAGEQEVAQICEDILQQEIEMAEWLIEHQEAIVVAFL 159
                  .***************************************************9998765 PP



Or compare VIMSS254968 to CDD or PaperBLAST