PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS318969 to PF05974 (DUF892)

VIMSS318969 has 431 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.9e-57  177.9   9.8    9.5e-57  177.6   7.5    2.0  2  VIMSS318969  


Domain annotation for each sequence (and alignments):
>> VIMSS318969  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.1   0.0     0.048     0.048     113     133 ..     143     163 ..     128     184 .. 0.72
   2 !  177.6   7.5   9.5e-57   9.5e-57       2     155 ..     257     411 ..     256     415 .. 0.96

  Alignments for each domain:
  == domain 1  score: -0.1 bits;  conditional E-value: 0.048
                  HHHHHHHHHCTT-HHHHHHHH CS
       DUF892 113 YgtLialAeqlgekeaaklLe 133
                  Y+ Li++++ +g k+a + L 
  VIMSS318969 143 YERLINFCDDAGTKDALQFLM 163
                  888888888888888877664 PP

  == domain 2  score: 177.6 bits;  conditional E-value: 9.5e-57
                  .HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT----------.-THHHHHHH. CS
       DUF892   2 leelfvdeLrDlyaaEkqllkalpkmakaaespeLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaa.edeslkdaal 98 
                  l++l++d+LrDl++aEkql+kalp+m++aa+ ++L + ++ Hl+eTe qierL+++fe lg+++++k c++m+gl++eg+e+i+e a +d+++ d+al
  VIMSS318969 257 LDDLLIDQLRDLLHAEKQLTKALPQMIEAARYDQLGELFTVHLAETEAQIERLDECFELLGKKPRAKACKGMQGLVEEGDEVIKEGArKDDAAADLAL 354
                  78*******************************************************************************998876156669***** PP

                  ..HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892  99 iaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvn 155
                  i+aaq+vehyEiA+Y+t+++lA+ql ++ +++lL ++l+ee+++d+ l+++a+sl+ 
  VIMSS318969 355 IGAAQRVEHYEIAGYTTARNLAQQLRHSAVVALLSKNLAEEENADQLLNQVARSLMS 411
                  ****************************************************99875 PP



Or compare VIMSS318969 to CDD or PaperBLAST