PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS58634 to PF05974 (DUF892)

VIMSS58634 has 169 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      1e-54  171.0   6.5    1.2e-54  170.9   6.5    1.0  1  VIMSS58634  


Domain annotation for each sequence (and alignments):
>> VIMSS58634  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  170.9   6.5   1.2e-54   1.2e-54       3     158 ..       5     157 ..       3     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: 170.9 bits;  conditional E-value: 1.2e-54
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH... CS
      DUF892   3 eelfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaalia 100
                 +e+++d+LrD++a+E+q++++l+++a+++e+ p+Lk+++eqH+eeT+gq + Le++++rl++s+s+ k d+ ++l+a gq++++++++de++k+a+   
  VIMSS58634   5 QENLLDWLRDAHAMEQQAEQMLKAQAARLEHyPQLKTRIEQHIEETHGQQRLLEECLKRLDSSPSTLK-DIGAKLMAFGQAVAGMTVSDEVVKGAM--- 99 
                 899*****************************************************************.***************************... PP

                 HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      DUF892 101 aaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqea 158
                 +++ +e++EiA+Y++Lia+A+++g++e+ + Le++l +e+a++++l++++++l+++++
  VIMSS58634 100 SGYVFENMEIAAYTVLIAAAREVGDAETLAALERILPQEQAMADWLRDHLPELTQAFL 157
                 ******************************************************9987 PP



Or compare VIMSS58634 to CDD or PaperBLAST