PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7575703 to PF05974 (DUF892)

VIMSS7575703 has 165 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    8.2e-49  151.9  14.6    9.2e-49  151.7  14.6    1.0  1  VIMSS7575703  


Domain annotation for each sequence (and alignments):
>> VIMSS7575703  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.7  14.6   9.2e-49   9.2e-49       2     155 ..       8     160 ..       7     164 .. 0.95

  Alignments for each domain:
  == domain 1  score: 151.7 bits;  conditional E-value: 9.2e-49
                   .HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH. CS
        DUF892   2 leelfvdeLrDlyaaEkqllkalpkmakaaespeLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaal 98 
                   l +l+v +L+++y+aE+q l+a+++  + ++++eLk+ l+ H+e+T++qi+rLeq+++++g+++   +  am+gl++e q l++++a++e ++ a+l
  VIMSS7575703   8 LTDLYVLKLQEIYSAEQQGLQAMQQGCDMVQTSELKQGLTMHIEQTQQQIQRLEQLLQKMGAQPASDTNLAMKGLVQELQRLMQQDASPE-VLEAGL 103
                   89***********************************************************************************66666.99**** PP

                   ..HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        DUF892  99 iaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvn 155
                   ia++qa+ehyEiA+Ygt++++A+ lg++ea+++Le+tl+eek tdekl+ +a+++  
  VIMSS7575703 104 IACQQAMEHYEIAGYGTARTYAQLLGDDEAVQMLERTLDEEKMTDEKLSMIAQQINV 160
                   ***************************************************986544 PP



Or compare VIMSS7575703 to CDD or PaperBLAST