PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS93122 to PF05974 (DUF892)

VIMSS93122 has 168 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.8e-53  165.9   0.2    4.2e-53  165.8   0.2    1.0  1  VIMSS93122  


Domain annotation for each sequence (and alignments):
>> VIMSS93122  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  165.8   0.2   4.2e-53   4.2e-53       4     157 ..       5     155 ..       2     157 .. 0.98

  Alignments for each domain:
  == domain 1  score: 165.8 bits;  conditional E-value: 4.2e-53
                 HHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH...H CS
      DUF892   4 elfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaaliaa 101
                 e+++d+LrD++a+Ekq++k+l++ma+++e+ peL++++eqH+ eT++q+ +Le++++r + s s +k d+m++++a gq +++ +++de++k+ +   +
  VIMSS93122   5 EHYHDWLRDAHAMEKQAEKMLESMASRIENyPELRSRIEQHISETKNQLSQLESILDRNNISRSVIK-DSMSKMAAFGQSIGGIFPSDEIVKGSI---S 99 
                 89*****************************************************************.***************************...* PP

                 HHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      DUF892 102 aqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqe 157
                 ++ +e++EiA+Y++L+a+A+++g++  + ++e++l+eek+++e+l ++++++++q+
  VIMSS93122 100 GYVFEQFEIACYTSLLAAAKNAGDTASVPIIEAILNEEKQMAEWLLNHIPDTTEQF 155
                 ***************************************************99987 PP



Or compare VIMSS93122 to CDD or PaperBLAST