VIMSS93298 has 168 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-55 173.2 0.3 2.5e-55 173.0 0.3 1.0 1 VIMSS93298 Domain annotation for each sequence (and alignments): >> VIMSS93298 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.0 0.3 2.5e-55 2.5e-55 4 158 .. 5 156 .. 2 157 .. 0.98 Alignments for each domain: == domain 1 score: 173.0 bits; conditional E-value: 2.5e-55 DUF892 4 elfideLrDayaaEkqalkalpkmakaaes.peLkaaleqHleeTeqqierleqvferlgeeasekkcdameglvaegqelleeaiedeevkdaaliaa 101 e+++d+LrDa+a+Ekqa+++l++ma+++++ peL+a++eqHl+eT++qi +le ++ r + + s +k d m++++a gq++++ + +de+vk+ + + VIMSS93298 5 EHYHDWLRDAHAMEKQAESMLESMASRIDNyPELRARIEQHLSETKNQIVQLETILDRNDISRSVIK-DSMSKMAALGQSIGGIFPSDEIVKGSI---S 99 89*****************************************************************.***************************...* PP DUF892 102 aqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 ++++e++Eia+Y++L+a+A+++g++ ++e++l+eEk+++++L +++++++++++ VIMSS93298 100 GYVFEQFEIACYTSLLAAAKNAGDTASIPIIEAILNEEKQMADWLIQHIPQTTEKFL 156 ****************************************************99875 PP
Or compare VIMSS93298 to CDD or PaperBLAST