PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS949889 to PF05974 (DUF892)

VIMSS949889 has 169 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-51  160.8   3.8    1.6e-51  160.6   3.8    1.0  1  VIMSS949889  


Domain annotation for each sequence (and alignments):
>> VIMSS949889  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  160.6   3.8   1.6e-51   1.6e-51       2     157 ..       4     156 ..       3     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: 160.6 bits;  conditional E-value: 1.6e-51
                  .HHHHHHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH. CS
       DUF892   2 leelfvdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaal 98 
                  ++e+++d+LrD++a+E+q++++l+++a+++e+ p+Lka++eqHleeT gq + +e  +erlg s+s +k dam +++a gq++++ +++de++k+a+ 
  VIMSS949889   4 PRENLMDWLRDAHAMEQQAEQMLKAQAARIEHyPKLKARIEQHLEETLGQQRLVEASIERLGGSPSVVK-DAMGKMAAFGQAMGGITTSDEIVKGAM- 99 
                  689******************************************************************.***************************. PP

                  ..HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       DUF892  99 iaaaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqe 157
                    a++ +e++EiA+Y+ L+ +A+++g+ e+++++eq+l +e+a++++l e++++l++++
  VIMSS949889 100 --ASYVFENLEIATYTALLGAAKTVGDVETQRMCEQILPQEEAMAKWLLEHLPELTEEF 156
                  ..*****************************************************9987 PP



Or compare VIMSS949889 to CDD or PaperBLAST