PaperBLAST – Find papers about a protein or its homologs

 

Align WP_041183281.1 to PF05974 (DUF892)

WP_041183281.1 has 161 amino acids

Query:       DUF892  [M=159]
Accession:   PF05974.12
Description: Domain of unknown function (DUF892)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      2e-45  140.9   1.0    2.2e-45  140.7   1.0    1.0  1  WP_041183281.1  


Domain annotation for each sequence (and alignments):
>> WP_041183281.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  140.7   1.0   2.2e-45   2.2e-45       7     157 ..       1     148 [.       1     150 [. 0.98

  Alignments for each domain:
  == domain 1  score: 140.7 bits;  conditional E-value: 2.2e-45
                     HHHHHHHHHHHHHHHHHHHHHHHH-SS.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------.-HHHHTTT-----------THHHHHHH... CS
          DUF892   7 vdeLrDlyaaEkqllkalpkmakaaes.peLkaaleqHleeTegqierLeqvferlgesasekkcdamegliaegqelieeaaedeslkdaalia 100
                     +d+LrD++a E+q++++ +++a+++ + p+ ka++eqHleeT gq + +e+++erlg s+s +k dam +l+a gq++++++++de++k+a+   
  WP_041183281.1   1 MDWLRDAHATEQQAEQMRKAQAARIAHyPQRKARIEQHLEETLGQRRLVESCIERLGGSPSVIK-DAMGKLAAFGQAMGGMTTSDEIVKGAM--- 91 
                     59**************************************************************.***************************... PP

                     HHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          DUF892 101 aaqavehyEiAsYgtLialAeqlgekeaaklLeqtleeekatdekltelaeslvnqe 157
                     a++ +e +EiA+ + L+ +A+++g+ e+++++eq+l +e+a++++l +++++ ++++
  WP_041183281.1  92 ASYVFETLEIATCTALLGAARTVGDIETQRVCEQILPQEQAMADWLLAHLPEPIKEF 148
                     **************************************************9988876 PP



Or compare WP_041183281.1 to CDD or PaperBLAST