VIMSS1236937 has 76 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.5e-28 82.6 4.2 9e-28 82.3 4.2 1.1 1 VIMSS1236937
Domain annotation for each sequence (and alignments):
>> VIMSS1236937
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.3 4.2 9e-28 9e-28 1 49 [] 25 73 .. 25 73 .. 0.98
Alignments for each domain:
== domain 1 score: 82.3 bits; conditional E-value: 9e-28
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
+yv++T+DG+tiv++gkP++D+dtGm++Y+d++G+++qIn+ dVk++ e
VIMSS1236937 25 NYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVE 73
7**********************************************87 PP
Or compare VIMSS1236937 to CDD or PaperBLAST