PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS149012 to PF06004 (DUF903)

VIMSS149012 has 84 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.12
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-19   56.5   5.6    1.4e-19   56.0   5.6    1.2  1  VIMSS149012  


Domain annotation for each sequence (and alignments):
>> VIMSS149012  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   56.0   5.6   1.4e-19   1.4e-19       2      49 .]      30      77 ..      29      77 .. 0.97

  Alignments for each domain:
  == domain 1  score: 56.0 bits;  conditional E-value: 1.4e-19
                 EEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
       DUF903  2 yvittkDGqtivtdgkPelDkdtGmyeYeDeeGkevqInkddVkqike 49
                 y++tt++G++i t+gkPe+D++tGm++Y D +G +++++++++ q +e
  VIMSS149012 30 YTMTTRTGEIIETQGKPEVDTATGMTKYADVYGYHRVMKTSEIVQTTE 77
                 9******************************************99876 PP



Or compare VIMSS149012 to CDD or PaperBLAST