PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS150283 to PF06004 (DUF903)

VIMSS150283 has 75 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.12
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.9e-29   85.4   4.1    1.2e-28   85.1   4.1    1.1  1  VIMSS150283  


Domain annotation for each sequence (and alignments):
>> VIMSS150283  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   85.1   4.1   1.2e-28   1.2e-28       1      48 [.      24      71 ..      24      72 .. 0.98

  Alignments for each domain:
  == domain 1  score: 85.1 bits;  conditional E-value: 1.2e-28
                 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEE CS
       DUF903  1 pyvittkDGqtivtdgkPelDkdtGmyeYeDeeGkevqInkddVkqik 48
                 +yv++t+DG+ ivtdgkP++D+dtGm++Y+D++G+++qIn+ dVk+++
  VIMSS150283 24 NYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMV 71
                 7*********************************************96 PP



Or compare VIMSS150283 to CDD or PaperBLAST