PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS16893 to PF06004 (DUF903)

VIMSS16893 has 75 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.12
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.6e-29   87.2   4.8    3.1e-29   87.0   4.8    1.1  1  VIMSS16893  


Domain annotation for each sequence (and alignments):
>> VIMSS16893  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.0   4.8   3.1e-29   3.1e-29       1      49 []      24      72 ..      24      72 .. 0.99

  Alignments for each domain:
  == domain 1  score: 87.0 bits;  conditional E-value: 3.1e-29
                EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEEE CS
      DUF903  1 pyvittkDGqtivtdgkPelDkdtGmyeYeDeeGkevqInkddVkqike 49
                +yv++t+DG+tiv+dgkP++D+dtGm++Y+D++G+++qIn+ dVk+++e
  VIMSS16893 24 NYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVE 72
                7**********************************************98 PP



Or compare VIMSS16893 to CDD or PaperBLAST