VIMSS335345 has 74 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-27 80.4 1.8 4e-27 80.2 1.8 1.1 1 VIMSS335345
Domain annotation for each sequence (and alignments):
>> VIMSS335345
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.2 1.8 4e-27 4e-27 1 48 [. 25 72 .. 25 73 .. 0.97
Alignments for each domain:
== domain 1 score: 80.2 bits; conditional E-value: 4e-27
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48
p+vit++DG++i+++++P++D+d+G+ye+++++Gk+++Inkd+V+++k
VIMSS335345 25 PTVITLNDGREIQAVDTPKYDEDSGFYEFKQLDGKQTRINKDQVRTVK 72
68********************************************98 PP
Or compare VIMSS335345 to CDD or PaperBLAST