PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS335345 to PF06004 (DUF903)

VIMSS335345 has 74 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.12
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-26   78.5   1.8    1.6e-26   78.3   1.8    1.1  1  VIMSS335345  


Domain annotation for each sequence (and alignments):
>> VIMSS335345  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.3   1.8   1.6e-26   1.6e-26       1      48 [.      25      72 ..      25      73 .. 0.97

  Alignments for each domain:
  == domain 1  score: 78.3 bits;  conditional E-value: 1.6e-26
                 EEEEEETTS-EEEEES--EE-TTTSCEEEEBTTS-EEEEEGGGEEEEE CS
       DUF903  1 pyvittkDGqtivtdgkPelDkdtGmyeYeDeeGkevqInkddVkqik 48
                 p+vit++DG++i+++++P++D+d+G+ye+++++Gk+++Inkd+V+++k
  VIMSS335345 25 PTVITLNDGREIQAVDTPKYDEDSGFYEFKQLDGKQTRINKDQVRTVK 72
                 68********************************************98 PP



Or compare VIMSS335345 to CDD or PaperBLAST