VIMSS514064 has 73 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.4e-24 70.0 3.5 7.8e-24 69.7 3.5 1.1 1 VIMSS514064
Domain annotation for each sequence (and alignments):
>> VIMSS514064
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.7 3.5 7.8e-24 7.8e-24 1 49 [] 24 71 .. 24 71 .. 0.98
Alignments for each domain:
== domain 1 score: 69.7 bits; conditional E-value: 7.8e-24
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
p+v++ +DG+++vt ++P++++dtG+yeYe+ +G++vq+nkddVk+I+e
VIMSS514064 24 PSVVQQRDGSQVVTPDEPKYNEDTGFYEYEK-DGHKVQMNKDDVKTIEE 71
69*****************************.***************98 PP
Or compare VIMSS514064 to CDD or PaperBLAST