VIMSS61973 has 70 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-21 61.9 1.4 2.5e-21 61.7 1.4 1.0 1 VIMSS61973
Domain annotation for each sequence (and alignments):
>> VIMSS61973
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.7 1.4 2.5e-21 2.5e-21 2 48 .. 22 68 .. 21 69 .. 0.97
Alignments for each domain:
== domain 1 score: 61.7 bits; conditional E-value: 2.5e-21
DUF903 2 yvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48
+v+t++DG++++ +++ ++Dk++++ye+e+++G+++ I+kd+V++I+
VIMSS61973 22 AVVTLQDGSEVLVKDQSDYDKYNDYYEFEQLNGDTILIKKDNVRTIR 68
79********************************************8 PP
Or compare VIMSS61973 to CDD or PaperBLAST