PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001260098.1 to PF06110 (DUF953)

NP_001260098.1 has 126 amino acids

Query:       DUF953  [M=119]
Accession:   PF06110.11
Description: Eukaryotic protein of unknown function (DUF953)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.2e-59  184.0   0.0    3.7e-59  183.8   0.0    1.0  1  NP_001260098.1  


Domain annotation for each sequence (and alignments):
>> NP_001260098.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  183.8   0.0   3.7e-59   3.7e-59       1     119 []       6     124 ..       6     124 .. 0.99

  Alignments for each domain:
  == domain 1  score: 183.8 bits;  conditional E-value: 3.7e-59
                     EEEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT-TTSHHHH..TS---SSSEEEE CS
          DUF953   1 sakgyeefekslkelekeskivfilFlgekdteGesWCPdCvkaepvieealkeapedvklvrvdvGdrevWkdpanpfRkdpklkltgvPtLlr 95 
                     ++kgy+ef+k+++ele+++++v++lF+g+kd++GesWCP+Cvkaepvi++alk+ap ++++v+vdvG+r++Wkd ++pfRkdp+++l+++PtLlr
  NP_001260098.1   6 NVKGYDEFTKKMEELENGDEPVHVLFSGGKDEKGESWCPYCVKAEPVIHDALKKAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLR 100
                     589******************************************************************************************** PP

                     ETSS-EE-HHHHH-HHHHHHHHH- CS
          DUF953  96 wkgkkrLeeeqiakksLvellfee 119
                     wk+++rL++e++++++Lve++fe+
  NP_001260098.1 101 WKRPQRLDGERCSNQDLVEMMFED 124
                     **********************96 PP



Or compare NP_001260098.1 to CDD or PaperBLAST