PaperBLAST – Find papers about a protein or its homologs

 

Align NP_080835.1 to PF06110 (DUF953)

NP_080835.1 has 123 amino acids

Query:       DUF953  [M=119]
Accession:   PF06110.11
Description: Eukaryotic protein of unknown function (DUF953)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-55  172.4   0.1    1.5e-55  172.2   0.1    1.0  1  NP_080835.1  


Domain annotation for each sequence (and alignments):
>> NP_080835.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  172.2   0.1   1.5e-55   1.5e-55       2     119 .]       9     122 ..       8     122 .. 0.98

  Alignments for each domain:
  == domain 1  score: 172.2 bits;  conditional E-value: 1.5e-55
                  EEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT-TTSHHHH..TS---SSSEEEEETSS CS
       DUF953   2 akgyeefekslkelekeskivfilFlgekdteGesWCPdCvkaepvieealkeapedvklvrvdvGdrevWkdpanpfRkdpklkltgvPtLlrwkgk 99 
                  ++g+eef+k++ke  +e k++f++F+g+kdteG+sWCPdCv+aepvi+e+lk+++ed+++++++vGd+++Wkdp+n+fR+  klk+t+vPtLl+++++
  NP_080835.1   9 VLGFEEFDKAVKE--HEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFRQ--KLKITAVPTLLKYGTP 102
                  79**********9..8889*************************************************************..99************** PP

                  -EE-HHHHH-HHHHHHHHH- CS
       DUF953 100 krLeeeqiakksLvellfee 119
                  ++L e++++++sLve++f+e
  NP_080835.1 103 QKLVESECCQSSLVEMIFSE 122
                  ******************86 PP



Or compare NP_080835.1 to CDD or PaperBLAST