PaperBLAST – Find papers about a protein or its homologs

 

Align NP_116120.1 to PF06110 (DUF953)

NP_116120.1 has 123 amino acids

Query:       DUF953  [M=119]
Accession:   PF06110.11
Description: Eukaryotic protein of unknown function (DUF953)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.2e-50  155.5   0.0    2.5e-50  155.3   0.0    1.0  1  NP_116120.1  


Domain annotation for each sequence (and alignments):
>> NP_116120.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  155.3   0.0   2.5e-50   2.5e-50       2     119 .]       9     122 ..       8     122 .. 0.97

  Alignments for each domain:
  == domain 1  score: 155.3 bits;  conditional E-value: 2.5e-50
                  EEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT-TTSHHHH..TS---SSSEEEEETSS CS
       DUF953   2 akgyeefekslkelekeskivfilFlgekdteGesWCPdCvkaepvieealkeapedvklvrvdvGdrevWkdpanpfRkdpklkltgvPtLlrwkgk 99 
                  + g+eef++++++  ++ k++f++F+g+kd  G+sWCPdCv+aepv++e+lk+++e +++++++vG++++Wkdp+n+fRk  +lk+t+vPtLl+++++
  NP_116120.1   9 VSGFEEFHRAVEQ--HNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRK--NLKVTAVPTLLKYGTP 102
                  789********98..7779*************************************************************..89************** PP

                  -EE-HHHHH-HHHHHHHHH- CS
       DUF953 100 krLeeeqiakksLvellfee 119
                  ++L e+++++ +Lve+lf+e
  NP_116120.1 103 QKLVESECLQANLVEMLFSE 122
                  ******************86 PP



Or compare NP_116120.1 to CDD or PaperBLAST