PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::T1SH39 to PF06110 (DUF953)

SwissProt::T1SH39 has 123 amino acids

Query:       DUF953  [M=119]
Accession:   PF06110.11
Description: Eukaryotic protein of unknown function (DUF953)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.9e-45  139.6   0.0    2.1e-45  139.4   0.0    1.0  1  SwissProt::T1SH39  


Domain annotation for each sequence (and alignments):
>> SwissProt::T1SH39  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  139.4   0.0   2.1e-45   2.1e-45       1     119 []       8     122 ..       8     122 .. 0.97

  Alignments for each domain:
  == domain 1  score: 139.4 bits;  conditional E-value: 2.1e-45
                        EEEHHHHHHHHHHH..TSSSEEEEEEB--B-TTS-BSSHHHHHHHHHHHHHHHH-SS-EEEEEEE---HHHHT-TTSHHHH..TS---SSSE CS
             DUF953   1 sakgyeefekslkelekeskivfilFlgekdteGesWCPdCvkaepvieealkeapedvklvrvdvGdrevWkdpanpfRkdpklkltgvPt 92 
                        +++gy+ef +++ e  ++ k +f++F+g+kd +G+sWCPdCv+aep+++  + ++pe +++++++vG+r++Wkd  n f+k  +lkl gvPt
  SwissProt::T1SH39   8 NVRGYDEFCQAVSE--RKGKDIFAYFSGDKDASGKSWCPDCVTAEPIVRGQMSHLPEGSVFIYCQVGERAYWKDSTNAFKK--TLKLSGVPT 95 
                        589*********99..7779*************************************************************..89******* PP

                        EEEETSS-EE-HHHHH-HHHHHHHHH- CS
             DUF953  93 LlrwkgkkrLeeeqiakksLvellfee 119
                        Llr++++++L ee++ k +Lv+++f+e
  SwissProt::T1SH39  96 LLRYGTPQKLVEEECFKADLVRMMFTE 122
                        *************************97 PP



Or compare SwissProt::T1SH39 to CDD or PaperBLAST