NP_001325459.1 has 279 amino acids
Query: SOK [M=89] Accession: PF06136.17 Description: SOSEKI protein DIX-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-24 72.3 0.1 3.9e-24 71.1 0.1 1.7 1 NP_001325459.1 Domain annotation for each sequence (and alignments): >> NP_001325459.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.1 0.1 3.9e-24 3.9e-24 46 89 .] 1 44 [. 1 44 [. 0.98 Alignments for each domain: == domain 1 score: 71.1 bits; conditional E-value: 3.9e-24 SOK 46 maslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89 ma lyswsskr+yknGfvw+dl+++d+i+p++g+eyvlkgs++l NP_001325459.1 1 MACLYSWSSKRTYKNGFVWYDLSDEDFIFPVHGQEYVLKGSQIL 44 999**************************************986 PP
Or compare NP_001325459.1 to CDD or PaperBLAST