VIMSS10078708 has 372 amino acids
Query: SOK [M=89] Accession: PF06136.17 Description: SOSEKI protein DIX-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-39 117.9 0.1 2e-38 116.9 0.1 1.6 1 VIMSS10078708 Domain annotation for each sequence (and alignments): >> VIMSS10078708 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 116.9 0.1 2e-38 2e-38 1 89 [] 13 101 .. 13 101 .. 0.98 Alignments for each domain: == domain 1 score: 116.9 bits; conditional E-value: 2e-38 SOK 1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89 v++vy+lsr+++++hph+l v++ s++g++lrdv + l+ rG +m+ +sws+kr yknG+vw+dl +ddli p +++eyvlkgse+l VIMSS10078708 13 VNLVYFLSRSGHVDHPHLLRVHHLSRNGVFLRDVKKWLADARGDAMPDAFSWSCKRRYKNGYVWQDLLDDDLITPISDNEYVLKGSEIL 101 679************************************************************************************86 PP
Or compare VIMSS10078708 to CDD or PaperBLAST