VIMSS10096816 has 343 amino acids
Query: SOK [M=89] Accession: PF06136.17 Description: SOSEKI protein DIX-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-51 157.4 0.1 9.6e-51 156.4 0.1 1.6 1 VIMSS10096816 Domain annotation for each sequence (and alignments): >> VIMSS10096816 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 156.4 0.1 9.6e-51 9.6e-51 1 89 [] 20 108 .. 20 108 .. 0.99 Alignments for each domain: == domain 1 score: 156.4 bits; conditional E-value: 9.6e-51 SOK 1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89 v+vvyylsrn++l+hphf+ev+lss++glyl+dvi+rln lrG+gma lyswsskr+yknGfvw+dl+++d+i+p++g+eyvlkgs++l VIMSS10096816 20 VPVVYYLSRNGRLDHPHFIEVPLSSHNGLYLKDVINRLNDLRGNGMACLYSWSSKRTYKNGFVWYDLSDEDFIFPVHGQEYVLKGSQIL 108 79************************************************************************************985 PP
Or compare VIMSS10096816 to CDD or PaperBLAST