VIMSS10110567 has 423 amino acids
Query: SOK [M=89] Accession: PF06136.17 Description: SOSEKI protein DIX-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-54 168.9 0.1 1.9e-54 168.2 0.1 1.3 1 VIMSS10110567 Domain annotation for each sequence (and alignments): >> VIMSS10110567 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 168.2 0.1 1.9e-54 1.9e-54 1 89 [] 47 135 .. 47 135 .. 0.99 Alignments for each domain: == domain 1 score: 168.2 bits; conditional E-value: 1.9e-54 SOK 1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89 v+vvyyl+rn+ql+hphf+ev+lss++glyl+dvi+rln lrGkgmaslyswsskrsyknGfvwhdl+edd+i+p++g+eyvlkgse+l VIMSS10110567 47 VPVVYYLCRNGQLDHPHFIEVTLSSHDGLYLKDVINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL 135 79************************************************************************************986 PP
Or compare VIMSS10110567 to CDD or PaperBLAST