P80193 has 383 amino acids
Query: GBBH-like_N [M=85] Accession: PF06155.16 Description: Gamma-butyrobetaine hydroxylase-like, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-21 62.0 0.0 7.9e-18 51.3 0.0 2.0 2 P80193 Domain annotation for each sequence (and alignments): >> P80193 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.3 0.0 7.9e-18 7.9e-18 9 84 .. 24 100 .. 19 101 .. 0.90 2 ! 16.4 0.0 6e-07 6e-07 6 37 .. 79 110 .. 75 124 .. 0.84 Alignments for each domain: == domain 1 score: 51.3 bits; conditional E-value: 7.9e-18 GBBH-like_N 9 kLeiewddgktselpaewLRvacpcaecrgp..gqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyL 84 ++++w+dg+ s +++ wLR++cpc c+ + ++++ + ++ed+++++++ ++ + ++++Dgh s Y +L P80193 24 GVSVTWADGRVSPFHNLWLRDNCPCGDCVYEvtREQVFLVADVPEDIQVQAVTIGDDGRLVVQWDDGHASA-YHPGWL 100 589**************************55568888888889**********999999***********8.887777 PP == domain 2 score: 16.4 bits; conditional E-value: 6e-07 GBBH-like_N 6 dsrkLeiewddgktselpaewLRvacpcaecr 37 d+ +L ++wddg++s+++ wLR + a+ P80193 79 DDGRLVVQWDDGHASAYHPGWLRAHAYDAQSL 110 6789********************98777665 PP
Or compare P80193 to CDD or PaperBLAST