PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS61502 to PF06155 (DUF971)

VIMSS61502 has 123 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.5e-28   83.8   0.0    6.8e-28   83.5   0.0    1.1  1  VIMSS61502  


Domain annotation for each sequence (and alignments):
>> VIMSS61502  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.5   0.0   6.8e-28   6.8e-28       1      85 []       7      88 ..       7      88 .. 0.96

  Alignments for each domain:
  == domain 1  score: 83.5 bits;  conditional E-value: 6.8e-28
      DUF971  1 iklskkgkrLeiewddgkesslpaelLRdacpcaecrkpgqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgiYsweyLr 85
                i+l+k++k+L++++ +  +++lpae+LR+++p+ae++++g+ +lq gk   +v+++ +ep+g+yal+l+f+Dghdsg+++w+yL+
  VIMSS61502  7 IQLHKASKTLTLRYGE-DSYDLPAEFLRVHSPSAEVQGHGNPVLQYGK--LNVGLVGVEPAGQYALKLSFDDGHDSGLFTWDYLY 88
                789***********65.678*****************88*********..**********************************6 PP



Or compare VIMSS61502 to CDD or PaperBLAST