WP_003459003.1 has 123 amino acids
Query: GBBH-like_N [M=85]
Accession: PF06155.16
Description: Gamma-butyrobetaine hydroxylase-like, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-31 94.6 0.0 3.3e-31 94.2 0.0 1.2 1 WP_003459003.1
Domain annotation for each sequence (and alignments):
>> WP_003459003.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 94.2 0.0 3.3e-31 3.3e-31 1 85 [] 7 88 .. 7 88 .. 0.97
Alignments for each domain:
== domain 1 score: 94.2 bits; conditional E-value: 3.3e-31
GBBH-like_N 1 irlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyLr 85
i+l+k+s++Le+++ + ++++l+ae+LRv++p+ae++g+g+ +lqtgk +v +++iep+gnya+++ f+Dghdsg+Y+weyL+
WP_003459003.1 7 IKLHKASKTLELRYGE-QSYQLSAEFLRVHSPSAEVQGHGKPILQTGK--LNVGLERIEPAGNYALKLCFDDGHDSGLYTWEYLY 88
799***********76.789*****************99*********..**********************************7 PP
Or compare WP_003459003.1 to CDD or PaperBLAST