WP_011790884.1 has 128 amino acids
Query: GBBH-like_N [M=85]
Accession: PF06155.16
Description: Gamma-butyrobetaine hydroxylase-like, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.9e-35 106.2 0.0 7.6e-35 105.8 0.0 1.1 1 WP_011790884.1
Domain annotation for each sequence (and alignments):
>> WP_011790884.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 105.8 0.0 7.6e-35 7.6e-35 2 85 .] 12 93 .. 11 93 .. 0.98
Alignments for each domain:
== domain 1 score: 105.8 bits; conditional E-value: 7.6e-35
GBBH-like_N 2 rlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyLr 85
+lk++sr Lei++d+g++++l++e+LRv++p+ae++g+g+ +l+t+k ++v+i++iepvgnyav+ivf+Dghd+g++sw++L+
WP_011790884.1 12 KLKRKSRILEISFDNGEQYQLSCEMLRVYSPSAEVHGHGNPKLVTHK--KNVNITSIEPVGNYAVKIVFDDGHDTGLFSWKVLY 93
799*********************************99*********..*********************************97 PP
Or compare WP_011790884.1 to CDD or PaperBLAST