PaperBLAST – Find papers about a protein or its homologs

 

Align XP_005253216.1 to PF06155 (DUF971)

XP_005253216.1 has 387 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.1e-19   57.2   0.7      2e-16   46.8   0.0    3.1  3  XP_005253216.1  


Domain annotation for each sequence (and alignments):
>> XP_005253216.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   46.8   0.0     2e-16     2e-16       8      84 ..      15      91 ..       9      92 .. 0.90
   2 !   16.7   0.1   4.8e-07   4.8e-07       6      39 ..      70     103 ..      66     114 .. 0.86
   3 ?    0.7   0.0     0.048     0.048       1      19 [.     278     296 ..     269     307 .. 0.78

  Alignments for each domain:
  == domain 1  score: 46.8 bits;  conditional E-value: 2e-16
          DUF971  8 krLeiewddgkesslpaelLRdacpcaecr.kp.gqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgiYsweyL 84
                    + ++i w d++es +pa +LRd+cpc  c+ ++ + r+l  ++++ +++i+ +  ++++ + +++ D+h s  ++ ++L
  XP_005253216.1 15 HLMQILWYDEEESLYPAVWLRDNCPCSDCYlDSaKARKLLVEALDVNIGIKGLI-FDRKKVYITWPDEHYSE-FQADWL 91
                    6799**************************844577777777779********9.****************9.**9999 PP

  == domain 2  score: 16.7 bits;  conditional E-value: 4.8e-07
          DUF971   6 kgkrLeiewddgkesslpaelLRdacpcaecrkp 39 
                     ++k++ i+w d++ s+++a +L++ c + + r +
  XP_005253216.1  70 DRKKVYITWPDEHYSEFQADWLKKRCFSKQARAK 103
                     6899************************999954 PP

  == domain 3  score: 0.7 bits;  conditional E-value: 0.048
          DUF971   1 iklskkgkrLeiewddgke 19 
                     i+l+ kg+ ++i++++ ++
  XP_005253216.1 278 IELDDKGQVVRINFNNATR 296
                     5678888888888887765 PP



Or compare XP_005253216.1 to CDD or PaperBLAST