PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006498885.1 to PF06155 (DUF971)

XP_006498885.1 has 387 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.6e-18   53.5   0.9      7e-16   45.0   0.1    3.1  3  XP_006498885.1  


Domain annotation for each sequence (and alignments):
>> XP_006498885.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.0   0.1     7e-16     7e-16       8      84 ..      15      91 ..       9      92 .. 0.90
   2 !   14.9   0.1   1.7e-06   1.7e-06       5      38 ..      69     102 ..      66     114 .. 0.85
   3 ?   -0.2   0.0     0.089     0.089       1      19 [.     278     296 ..     278     309 .. 0.81

  Alignments for each domain:
  == domain 1  score: 45.0 bits;  conditional E-value: 7e-16
          DUF971  8 krLeiewddgkesslpaelLRdacpcaecr.kp.gqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgiYsweyL 84
                    + ++i w+dg es +pa +LRd+c+c  c+ ++ + r+l  ++++ +++i +++ ++++ + +++ ++h s  ++ ++L
  XP_006498885.1 15 HLMQIFWHDGAESLYPAVWLRDNCQCSDCYlHSaKARKLLLEALDVNIRIDDLT-FDRKKVYITWPNDHYSE-FEANWL 91
                    6799**************************855677877777779********9.****************9.999998 PP

  == domain 2  score: 14.9 bits;  conditional E-value: 1.7e-06
          DUF971   5 kkgkrLeiewddgkesslpaelLRdacpcaecrk 38 
                      ++k++ i+w + + s+++a +L++ c +++ r 
  XP_006498885.1  69 FDRKKVYITWPNDHYSEFEANWLKKRCFSQQARA 102
                     57899************************99883 PP

  == domain 3  score: -0.2 bits;  conditional E-value: 0.089
          DUF971   1 iklskkgkrLeiewddgke 19 
                     i+l+ kg+ +++++++ ++
  XP_006498885.1 278 IELDDKGQVVRVNFNNATR 296
                     679999********99876 PP



Or compare XP_006498885.1 to CDD or PaperBLAST