PaperBLAST – Find papers about a protein or its homologs

 

Align XP_017447515.1 to PF06155 (DUF971)

XP_017447515.1 has 387 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.8e-20   58.7   0.2    2.1e-16   46.7   0.0    3.2  3  XP_017447515.1  


Domain annotation for each sequence (and alignments):
>> XP_017447515.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   46.7   0.0   2.1e-16   2.1e-16       7      84 ..      14      91 ..       9      92 .. 0.90
   2 !   17.8   0.0   2.2e-07   2.2e-07       5      37 ..      69     101 ..      62     114 .. 0.87
   3 ?    0.5   0.0     0.056     0.056       1      19 [.     278     296 ..     278     309 .. 0.81

  Alignments for each domain:
  == domain 1  score: 46.7 bits;  conditional E-value: 2.1e-16
          DUF971  7 gkrLeiewddgkesslpaelLRdacpcaecr.kp.gqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgiYsweyL 84
                     + ++i w+dg es +pa +LRd+c+c  c+ ++ + r+l  ++++ ++++ +++ ++++ + +++ +gh s  ++ ++L
  XP_017447515.1 14 ARLMQIFWHDGAESLYPAVWLRDNCQCSDCYlHSaKARKLLLEALDVNIRMDDLT-FDQKKVYITWPNGHYSE-FEANWL 91
                    5789***************************855677877777779999999999.****************9.999998 PP

  == domain 2  score: 17.8 bits;  conditional E-value: 2.2e-07
          DUF971   5 kkgkrLeiewddgkesslpaelLRdacpcaecr 37 
                      ++k++ i+w +g+ s+++a +L++ c ++e r
  XP_017447515.1  69 FDQKKVYITWPNGHYSEFEANWLKKRCFSQEAR 101
                     58899*************************998 PP

  == domain 3  score: 0.5 bits;  conditional E-value: 0.056
          DUF971   1 iklskkgkrLeiewddgke 19 
                     i+l+ kg+ ++i++++ ++
  XP_017447515.1 278 IELDDKGQVVRINFNNATR 296
                     679999********99876 PP



Or compare XP_017447515.1 to CDD or PaperBLAST