biolip::3o2gA has 386 amino acids
Query: GBBH-like_N [M=85] Accession: PF06155.16 Description: Gamma-butyrobetaine hydroxylase-like, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-20 59.2 0.8 4.1e-17 49.0 0.1 3.0 3 biolip::3o2gA Domain annotation for each sequence (and alignments): >> biolip::3o2gA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.0 0.1 4.1e-17 4.1e-17 8 84 .. 16 92 .. 10 93 .. 0.91 2 ! 16.6 0.1 5.4e-07 5.4e-07 6 42 .. 71 107 .. 67 116 .. 0.86 3 ? 0.8 0.0 0.045 0.045 52 79 .. 275 301 .. 239 305 .. 0.72 Alignments for each domain: == domain 1 score: 49.0 bits; conditional E-value: 4.1e-17 GBBH-like_N 8 rkLeiewddgktselpaewLRvacpcaecr..gpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyL 84 + ++i w d+++s +pa wLR++cpc+ c+ + + r+l + ++ ++ ik + ++++v i++ D+h s ++ ++L biolip::3o2gA 16 HLMQILWYDEEESLYPAVWLRDNCPCSDCYldSAKARKLLVEALDVNIGIKGLI-FDRKKVYITWPDEHYSE-FQADWL 92 689***************************95448888888888*********9.9***************9.***999 PP == domain 2 score: 16.6 bits; conditional E-value: 5.4e-07 GBBH-like_N 6 dsrkLeiewddgktselpaewLRvacpcaecrgpgqr 42 d++k+ i+w d++ se++a wL++ c + + r + qr biolip::3o2gA 71 DRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQR 107 67899***********************999955443 PP == domain 3 score: 0.8 bits; conditional E-value: 0.045 GBBH-like_N 52 dvkikeiepvgnyavrivfsDghdsgiY 79 + ki e++ g + vri+f++ + +i+ biolip::3o2gA 275 KHKIIELDDKG-QVVRINFNNATRDTIF 301 55666666666.6677777776666666 PP
Or compare biolip::3o2gA to CDD or PaperBLAST