reanno::MR1:203247 has 128 amino acids
Query: GBBH-like_N [M=85] Accession: PF06155.16 Description: Gamma-butyrobetaine hydroxylase-like, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-35 105.9 0.0 9.2e-35 105.6 0.0 1.1 1 reanno::MR1:203247 Domain annotation for each sequence (and alignments): >> reanno::MR1:203247 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.6 0.0 9.2e-35 9.2e-35 2 85 .] 12 93 .. 11 93 .. 0.98 Alignments for each domain: == domain 1 score: 105.6 bits; conditional E-value: 9.2e-35 GBBH-like_N 2 rlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyLr 85 +lk++sr Lei++d+g++++l++e+LRv++p+ae++g+g+ +l+t+k ++v+i++iepvgnyav+ivf+Dghd+g++sw++L+ reanno::MR1:203247 12 KLKRKSRILEISFDNGEQYQLTCEMLRVYSPSAEVHGHGNPKLVTHK--KNVNITRIEPVGNYAVKIVFDDGHDTGLFSWQVLY 93 799*********************************99*********..*********************************97 PP
Or compare reanno::MR1:203247 to CDD or PaperBLAST