PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::MR1:203247 to PF06155 (DUF971)

reanno::MR1:203247 has 128 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
    3.9e-33  100.3   0.0    5.1e-33   99.9   0.0    1.1  1  reanno::MR1:203247  


Domain annotation for each sequence (and alignments):
>> reanno::MR1:203247  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.9   0.0   5.1e-33   5.1e-33       2      85 .]      12      93 ..      11      93 .. 0.97

  Alignments for each domain:
  == domain 1  score: 99.9 bits;  conditional E-value: 5.1e-33
              DUF971  2 klskkgkrLeiewddgkesslpaelLRdacpcaecrkpgqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgiYsweyLr 85
                        kl++k++ Lei++d+g++++l++e LR+++p+ae++++g+ +l+++k  k+v+i++iepvgnya+++vf+Dghd+g++sw++L+
  reanno::MR1:203247 12 KLKRKSRILEISFDNGEQYQLTCEMLRVYSPSAEVHGHGNPKLVTHK--KNVNITRIEPVGNYAVKIVFDDGHDTGLFSWQVLY 93
                        799*********************************889999*****..*********************************96 PP



Or compare reanno::MR1:203247 to CDD or PaperBLAST