reanno::MR1:203247 has 128 amino acids
Query: GBBH-like_N [M=85]
Accession: PF06155.16
Description: Gamma-butyrobetaine hydroxylase-like, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.2e-35 105.9 0.0 9.2e-35 105.6 0.0 1.1 1 reanno::MR1:203247
Domain annotation for each sequence (and alignments):
>> reanno::MR1:203247
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 105.6 0.0 9.2e-35 9.2e-35 2 85 .] 12 93 .. 11 93 .. 0.98
Alignments for each domain:
== domain 1 score: 105.6 bits; conditional E-value: 9.2e-35
GBBH-like_N 2 rlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyLr 85
+lk++sr Lei++d+g++++l++e+LRv++p+ae++g+g+ +l+t+k ++v+i++iepvgnyav+ivf+Dghd+g++sw++L+
reanno::MR1:203247 12 KLKRKSRILEISFDNGEQYQLTCEMLRVYSPSAEVHGHGNPKLVTHK--KNVNITRIEPVGNYAVKIVFDDGHDTGLFSWQVLY 93
799*********************************99*********..*********************************97 PP
Or compare reanno::MR1:203247 to CDD or PaperBLAST