PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::SB2B:6936240 to PF06155 (GBBH-like_N)

reanno::SB2B:6936240 has 126 amino acids

Query:       GBBH-like_N  [M=85]
Accession:   PF06155.16
Description: Gamma-butyrobetaine hydroxylase-like, N-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    1.9e-35  107.8   0.0    2.3e-35  107.5   0.0    1.1  1  reanno::SB2B:6936240  


Domain annotation for each sequence (and alignments):
>> reanno::SB2B:6936240  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  107.5   0.0   2.3e-35   2.3e-35       2      85 .]      10      91 ..       9      91 .. 0.98

  Alignments for each domain:
  == domain 1  score: 107.5 bits;  conditional E-value: 2.3e-35
           GBBH-like_N  2 rlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyLr 85
                          +lk++sr Le+ +ddg++++l++e+LRv++p+ae++g+g+ +l+t+k  +dv+i++iepvgnyav++vf+Dghd+g+Ysw++L+
  reanno::SB2B:6936240 10 KLKRKSRLLEVGFDDGSQYQLSCEFLRVYSPSAEVHGHGNPVLVTHK--KDVNITAIEPVGNYAVKLVFDDGHDTGLYSWQVLH 91
                          799*********************************99*********..*********************************96 PP



Or compare reanno::SB2B:6936240 to CDD or PaperBLAST