reanno::SB2B:6936240 has 126 amino acids
Query: GBBH-like_N [M=85] Accession: PF06155.16 Description: Gamma-butyrobetaine hydroxylase-like, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-35 107.8 0.0 2.3e-35 107.5 0.0 1.1 1 reanno::SB2B:6936240 Domain annotation for each sequence (and alignments): >> reanno::SB2B:6936240 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.5 0.0 2.3e-35 2.3e-35 2 85 .] 10 91 .. 9 91 .. 0.98 Alignments for each domain: == domain 1 score: 107.5 bits; conditional E-value: 2.3e-35 GBBH-like_N 2 rlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyLr 85 +lk++sr Le+ +ddg++++l++e+LRv++p+ae++g+g+ +l+t+k +dv+i++iepvgnyav++vf+Dghd+g+Ysw++L+ reanno::SB2B:6936240 10 KLKRKSRLLEVGFDDGSQYQLSCEFLRVYSPSAEVHGHGNPVLVTHK--KDVNITAIEPVGNYAVKLVFDDGHDTGLYSWQVLH 91 799*********************************99*********..*********************************96 PP
Or compare reanno::SB2B:6936240 to CDD or PaperBLAST