PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::SB2B:6936240 to PF06155 (DUF971)

reanno::SB2B:6936240 has 126 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    1.2e-33  101.9   0.0    1.5e-33  101.6   0.0    1.1  1  reanno::SB2B:6936240  


Domain annotation for each sequence (and alignments):
>> reanno::SB2B:6936240  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.6   0.0   1.5e-33   1.5e-33       2      85 .]      10      91 ..       9      91 .. 0.97

  Alignments for each domain:
  == domain 1  score: 101.6 bits;  conditional E-value: 1.5e-33
                DUF971  2 klskkgkrLeiewddgkesslpaelLRdacpcaecrkpgqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgiYsweyLr 85
                          kl++k++ Le+ +ddg++++l++e+LR+++p+ae++++g+ +l+++k  kdv+i++iepvgnya++lvf+Dghd+g+Ysw++L+
  reanno::SB2B:6936240 10 KLKRKSRLLEVGFDDGSQYQLSCEFLRVYSPSAEVHGHGNPVLVTHK--KDVNITAIEPVGNYAVKLVFDDGHDTGLYSWQVLH 91
                          799*********************************88*********..********************************996 PP



Or compare reanno::SB2B:6936240 to CDD or PaperBLAST