PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo1_N1B4:Pf1N1B4_1554 to PF06155 (DUF971)

reanno::pseudo1_N1B4:Pf1N1B4_1554 has 125 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    3.9e-30   90.7   0.0    4.9e-30   90.4   0.0    1.1  1  reanno::pseudo1_N1B4:Pf1N1B4_1554  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo1_N1B4:Pf1N1B4_1554  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.4   0.0   4.9e-30   4.9e-30       1      85 []       8      90 ..       8      90 .. 0.98

  Alignments for each domain:
  == domain 1  score: 90.4 bits;  conditional E-value: 4.9e-30
                             DUF971  1 iklskkgkrLeiewddgkesslpaelLRdacpcaecrkpgqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgi 78
                                       ikl+k++k+L+++++ g+e++lpae+LR+++p+ae++++g+ +lq gk    v++ ++ep+g+yal+l+f+Dghdsg+
  reanno::pseudo1_N1B4:Pf1N1B4_1554  8 IKLHKASKTLSLKYASGEEYHLPAEFLRVHSPSAEVQGHGKPILQFGK--IGVGLSKVEPAGQYALKLTFDDGHDSGL 83
                                       799**********************************98*********..9*************************** PP

                             DUF971 79 YsweyLr 85
                                       ++weyL+
  reanno::pseudo1_N1B4:Pf1N1B4_1554 84 FTWEYLY 90
                                       ******6 PP



Or compare reanno::pseudo1_N1B4:Pf1N1B4_1554 to CDD or PaperBLAST