PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo3_N2E3:AO353_12420 to PF06155 (DUF971)

reanno::pseudo3_N2E3:AO353_12420 has 126 amino acids

Query:       DUF971  [M=85]
Accession:   PF06155.12
Description: Protein of unknown function (DUF971)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    1.6e-29   88.7   0.0      2e-29   88.4   0.0    1.1  1  reanno::pseudo3_N2E3:AO353_12420  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo3_N2E3:AO353_12420  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.4   0.0     2e-29     2e-29       1      85 []       9      91 ..       9      91 .. 0.98

  Alignments for each domain:
  == domain 1  score: 88.4 bits;  conditional E-value: 2e-29
                            DUF971  1 iklskkgkrLeiewddgkesslpaelLRdacpcaecrkpgqrllqsgkipkdvkiesiepvgnyalrlvfsDghdsgiY 79
                                      ikl+k++k+Le++++  + ++l+ae+LR+++p+ae++++g+ +lq gk    v+++++ep+g+yal+l+f+Dghdsg++
  reanno::pseudo3_N2E3:AO353_12420  9 IKLHKASKTLELQYAPDEIYHLSAEFLRVHSPSAEVQGHGKPILQFGK--IGVGLTKVEPAGQYALKLTFDDGHDSGLF 85
                                      79***********************************98*********..9**************************** PP

                            DUF971 80 sweyLr 85
                                      +weyL+
  reanno::pseudo3_N2E3:AO353_12420 86 TWEYLY 91
                                      *****6 PP



Or compare reanno::pseudo3_N2E3:AO353_12420 to CDD or PaperBLAST