PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001033515.2 to PF06237 (DUF1011)

NP_001033515.2 has 427 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.5e-32   95.8  10.2    8.5e-32   95.8  10.2    2.5  3  NP_001033515.2  


Domain annotation for each sequence (and alignments):
>> NP_001033515.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.2      0.25      0.25       5      15 ..      77      87 ..      49      94 .. 0.59
   2 ?   -3.9   0.5      0.99      0.99      70      78 ..     191     199 ..     182     207 .. 0.39
   3 !   95.8  10.2   8.5e-32   8.5e-32       3      99 .]     260     356 ..     258     356 .. 0.98

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.25
         DUF1011  5 afllvllaivn 15
                    +f++++la+++
  NP_001033515.2 77 IFIFMVLACIC 87
                    23333333333 PP

  == domain 2  score: -3.9 bits;  conditional E-value: 0.99
         DUF1011  70 ltllgllls 78 
                     +++++ +++
  NP_001033515.2 191 FFFTCAAVA 199
                     222222222 PP

  == domain 3  score: 95.8 bits;  conditional E-value: 8.5e-32
         DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgst 97 
                     +lafll+++a+vna +nG+++svqsY++l Y++++Yh++vtls++++Pla++l++f+++rsl +l++ltl+++l++a i++lA+lsP+++++++t
  NP_001033515.2 260 RLAFLLLTTALVNAQMNGIVTSVQSYATLVYSQNTYHYAVTLSNVISPLASYLQFFVKIRSLPILAFLTLCSSLTTAVIIYLAALSPNWIFNSET 354
                     789*****************************************************************************************999 PP

         DUF1011  98 lG 99 
                     +G
  NP_001033515.2 355 AG 356
                     87 PP



Or compare NP_001033515.2 to CDD or PaperBLAST