PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001256040.1 to PF06237 (DUF1011)

NP_001256040.1 has 463 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.7e-32   95.8  13.1    8.7e-32   95.8  13.1    2.9  3  NP_001256040.1  


Domain annotation for each sequence (and alignments):
>> NP_001256040.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.3   0.7     0.078     0.078       6      24 ..     113     131 ..     109     166 .. 0.65
   2 ?   -2.3   0.2      0.32      0.32      58      71 ..     188     201 ..     178     211 .. 0.46
   3 !   95.8  13.1   8.7e-32   8.7e-32       4      99 .]     294     389 ..     292     389 .. 0.97

  Alignments for each domain:
  == domain 1  score: -0.3 bits;  conditional E-value: 0.078
         DUF1011   6 fllvllaivnaltnGvlps 24 
                      ll+ laivna++n ++ +
  NP_001256040.1 113 SLLFGLAIVNAMSNVLFMP 131
                     5777888888888876654 PP

  == domain 2  score: -2.3 bits;  conditional E-value: 0.32
         DUF1011  58 flpvrslkvlgvlt 71 
                     f+ + s++++++++
  NP_001256040.1 188 FFVIFSFTCVALFA 201
                     22222222222222 PP

  == domain 3  score: 95.8 bits;  conditional E-value: 8.7e-32
         DUF1011   4 lafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgstl 98 
                     ++fll+++a+vna +nG+++svqsY++lpY++ +Yh++vtls++++Pl++fl +f++vrs+ vl++lt+++++++a+i++lA+lsP+ ++++ t+
  NP_001256040.1 294 FTFLLFTTALVNAQMNGIITSVQSYAALPYSQATYHFAVTLSNVVSPLSSFLPFFISVRSIPVLAILTACSTAMTAFIVYLAALSPNLIFNSVTI 388
                     689**************************************************************************************999887 PP

         DUF1011  99 G 99 
                     G
  NP_001256040.1 389 G 389
                     6 PP



Or compare NP_001256040.1 to CDD or PaperBLAST