PaperBLAST – Find papers about a protein or its homologs

 

Align NP_081448.2 to PF06237 (DUF1011)

NP_081448.2 has 460 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      8e-44  134.4   7.3      8e-44  134.4   7.3    2.9  3  NP_081448.2  


Domain annotation for each sequence (and alignments):
>> NP_081448.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.0   0.2      0.13      0.13      50      86 ..      55      91 ..      43     101 .. 0.55
   2 ?   -1.7   0.8       0.2       0.2      52      83 ..      85     117 ..      77     128 .. 0.50
   3 !  134.4   7.3     8e-44     8e-44       3      98 ..     290     385 ..     288     386 .. 0.97

  Alignments for each domain:
  == domain 1  score: -1.0 bits;  conditional E-value: 0.13
      DUF1011 50 PlacflamflpvrslkvlgvltllglllsaYilalAv 86
                 Pl ++l+  ++   l+ + v++l+ ++ +a +++lA+
  NP_081448.2 55 PLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAF 91
                 4444444444444455555555555555555555554 PP

  == domain 2  score: -1.7 bits;  conditional E-value: 0.2
      DUF1011  52 acfl.amflpvrslkvlgvltllglllsaYila 83 
                  ac+l a++++v+s    g  ++++++l+ ++ +
  NP_081448.2  85 ACILlAFLWNVTSWIQGGQHSVAFIVLTFFLAL 117
                  444404444445444444444444444444444 PP

  == domain 3  score: 134.4 bits;  conditional E-value: 8e-44
      DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgstl 98 
                  qlaf+++++a+vnaltnGvlpsvq+YsclpYG +aYhls+tlss+a+Placfl +flp+rsl +lgvlt+lg+ ++aY++a+A++sP+p+L+g++ 
  NP_081448.2 290 QLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGAYNMAMAAMSPCPVLQGHWG 385
                  899*****************************************************************************************9875 PP



Or compare NP_081448.2 to CDD or PaperBLAST