PaperBLAST – Find papers about a protein or its homologs

 

Align NP_651901.3 to PF06237 (DUF1011)

NP_651901.3 has 487 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.9e-39  118.3   8.4    7.9e-39  118.3   8.4    3.6  4  NP_651901.3  


Domain annotation for each sequence (and alignments):
>> NP_651901.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   1.5     0.042     0.042      48      89 ..     152     194 ..     144     200 .. 0.74
   2 ?   -3.3   0.5      0.65      0.65       7      18 ..     268     279 ..     262     286 .. 0.39
   3 !  118.3   8.4   7.9e-39   7.9e-39       2      99 .]     321     418 ..     320     418 .. 0.98
   4 ?    0.2   0.2     0.053     0.053      62      86 ..     450     474 ..     424     481 .. 0.83

  Alignments for each domain:
  == domain 1  score: 0.5 bits;  conditional E-value: 0.042
      DUF1011  48 anPlacflamflpvrslkvlgv.ltllglllsaYilalAvlsP 89 
                  + +++c+l+ f+ ++  +v g+  +l+ +ll++++ + A++s 
  NP_651901.3 152 VGAISCLLTAFFYNQTASVAGTdHSLALFLLTCFTALNACTSS 194
                  6789999999888877777776245666677788888888775 PP

  == domain 2  score: -3.3 bits;  conditional E-value: 0.65
      DUF1011   7 llvllaivnalt 18 
                  +l+ l+++  + 
  NP_651901.3 268 ILFALMVLAYVG 279
                  222233333333 PP

  == domain 3  score: 118.3 bits;  conditional E-value: 7.9e-39
      DUF1011   2 aqlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgstlG 99 
                   q+++ll+l++++++++nG++ s+qsYs++pYG++aYhl++tls ianP+acf+amfl+ +sl++++vl++l+ ll++Y++++A+lsP ppL+++t+G
  NP_651901.3 321 GQYTYLLLLIGAISLFSNGMFGSIQSYSSAPYGSQAYHLAATLSVIANPVACFMAMFLHFTSLRIITVLSILAGLLTSYVFTTAALSPLPPLHDQTVG 418
                  589********************************************************************************************998 PP

  == domain 4  score: 0.2 bits;  conditional E-value: 0.053
      DUF1011  62 rslkvlgvltllglllsaYilalAv 86 
                  +sl+++g++t lg++++a +++ A+
  NP_651901.3 450 QSLVWVGAITQLGSAIGAVAIFFAI 474
                  8999999999999999999999987 PP



Or compare NP_651901.3 to CDD or PaperBLAST